Fusion Glycoprotein F0

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Fusion Glycoprotein F0
  Conformer 1
(PDB) 		6mjz (A)
  Conformer 2
(PDB) 		1ztm (A)
  Window Length 11
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 310 15.03   27 - 146   190 - 426
2 24 5.12   166 - 189

Sequence


           _________________________________________________________________________94_____________________________________________ 
 6mjz(A) : IDITKLQHVGVLVNSPKGMKISQNFETRYLILSLIPKIEDSNSCGDQQIKQYKRLLDRLIIPLYDGLKLQKDVIVTaTSAQITAAVALVEAKQAKSDIEKLKEAIRDTNKAVQSVCSSVG 
         :                                                                                                                          
 1ztm(A) : **ITKLQHVGVLVNSPKGMKISQNFETRYLILSLIPKIEDSNSCGDQQIKQYKRLLDRLIIPLYDGLRLQKDVIV--------------------sDIEKLKEAIRDTNKAVQSVQSSIG 
           _________________________________________________________________________94_____________________________________________ 

           ____________________189_________________________________________________________________________________________________ 
 6mjz(A) : NCIVAIKSVQDYVNKEIVPSIARLGCEAAGLQLGIALTQHYSELTNCFGDNIGSLQEKGIKLQCIASLYRTNITEIFTTSTVDKYDIYDLLFTESIKVRVIDVDLNDYSITLQVRLPLLT 
         :                                                                                                                          
 1ztm(A) : NLIVAIKSVQDYVNKEIVPSIARLGCEAAGLQLGIALTQHYSELTNIFGDNIGSLQEKGIKLQGIASLYRTNITEIFTTSTVDKYDIYDLLFTESIKVRVIDVDLNDYSITLQVRLPLLT 
           ____________________189_________________________________________________________________________________________________ 

           ________________________________________________________________________________________________________________________ 
 6mjz(A) : RLLNTQIYKVDSISYNIQNREWYIPLPSHIMTKGAFLGGADVKECIEAFSSYICPSDPGFVLNHEMESCLSGNISQCPRTTVTSDIVPRYAFVNGGVVANCITTTCTCNGIGNRINQPPD 
         :                                                                                                                          
 1ztm(A) : RLLNTQIYRVDSISYNIQNREWYIPLPSHIMTKGAFLGGADVKECIEAFSSYICPSDPGFVLNHEMESCLSGNISQCPRTVVKSDIVPRYAFVNGGVVANCITTTCTCNGIGNRINQPPD 
           ________________________________________________________________________________________________________________________ 

           ______________________________________________________________________________                                           
 6mjz(A) : QGVKIITHKECNTIGINGMLFNTNKEGTLAFYTPDDITLNNSVALDPIDISIELNKVKSDLEESKE************                                           
         :                                                                                                                          
 1ztm(A) : QGVKIITHKECNTIGINGMLFNTNKEGTLAFYTPNDITLNNSVALDPIDISIELNKAKSDLEESKEWIRRSNQKLDSI                                           
           ______________________________________________________________________________                                           

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		157.0
Translation
(A) 		0.4
Closure
(%) 		81.9
Bending Residues
( green ) 		  94 - 166
  189 - 190
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download