Rhombotin-2

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Rhombotin-2
  Conformer 1
(PDB) 		2xjy (A)
  Conformer 2
(PDB) 		4kfz (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 63 1.6   29 - 91
2 63 2.08   92 - 154

Sequence


           _____________________________________________________________________________89_________________________________________ 
 2xjy(A) : ***************SLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFC 
         :                                                                                                                          
 4kfz(A) : DPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFC 
           _____________________________________________________________________________89_________________________________________ 

           __________________________                                                                                               
 2xjy(A) : VGDRYLLINSDIVCEQDIYEWTKING                                                                                               
         :                                                                                                                          
 4kfz(A) : VGDRYLLINSDIVCEQDIYEWTKING                                                                                               
           __________________________                                                                                               

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		60.6
Translation
(A) 		-1.8
Closure
(%) 		18.0
Bending Residues
( green ) 		  89 - 92
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download