DynDom - Protein Domain Motions

Adhesin A

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

Property	Value
Name	Adhesin A
Conformer 1 (PDB)	3etw (A)
Conformer 2 (PDB)	3etx (A)
Window Length	5
Minimum ratio	1.0
Minimum domain size	20

Domains

Domain	Size	Backbone RMSD (A)	Residues
1	36	0.35	41 - 63 85 - 97
2	22	0.3	19 - 40
3	21	0.51	64 - 84

Sequence

`___________________________________40____________________62____________________84____________________________` `3etw(A) : AASLVGELQALDAEYQNLANQEEARFNEERAQADAARQALAQNEQVYNELSQRAQRLQAEANTRFYKSQYQELASKYEDALKKLEAEMEQQKAVISDFEKIQALRAGNL` `:` `3etx(A) : ASLVGELQAADAEYQNLANQEEARFNEERAQADAARQALAQNEQVYNELSQRAQRLQAEANTRFYKSQYQELASKYEDALKKLEAEMEQQKAVISDFEKIQALRAG*` `___________________________________40____________________62____________________84____________________________`

Morph

Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.

Show console

play backwards

pause

play forwards

Domain Pairs

Property	Value
Fixed Domain ( blue )	1
Moving Domain ( red )	2
Rotation Angle (deg)	5.4
Translation (A)	0.3
Closure (%)	20.9
Bending Residues ( green )	40 - 41
Bending Region Analysis

Property	Value
Fixed Domain ( blue )	1
Moving Domain ( yellow )	3
Rotation Angle (deg)	8.2
Translation (A)	-0.1
Closure (%)	2.5
Bending Residues ( green )	62 - 66 84 - 85
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Mixed

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file