Adhesin A

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Adhesin A
  Conformer 1
(PDB) 		3etw (A)
  Conformer 2
(PDB) 		3ety (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 41 0.38   33 - 48   81 - 105
2 25 0.38   8 - 32
3 32 0.49   49 - 80

Sequence


           ___________________________32______________48______________________________80________________________________            
 3etw(A) : AASLVGELQALDAEYQNLANQEEARFNEERAQADAARQALAQNEQVYNELSQRAQRLQAEANTRFYKSQYQELASKYEDALKKLEAEMEQQKAVISDFEKIQALRAGNL            
         :                                                                                                                          
 3ety(A) : AASLVGELQAADAEYQNLANQEEARFNEERAQADAARQALAQNEQVYNELSQRAQRLQAEANTRFYKSQYQELASKYEDALKKLEAEMEQQKAVISDFEKIQAL*****            
           ___________________________32______________48______________________________80________________________________            

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		8.0
Translation
(A) 		0.8
Closure
(%) 		93.8
Bending Residues
( green ) 		  32 - 33
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		8.8
Translation
(A) 		0.2
Closure
(%) 		87.6
Bending Residues
( green ) 		  48 - 49
  80 - 81
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download