Adhesin A

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Adhesin A
  Conformer 1
(PDB) 		3etw (A)
  Conformer 2
(PDB) 		3etz (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 57 0.27   27 - 63   80 - 81   86 - 103
2 20 0.32   64 - 79   82 - 85

Sequence


           ________________________________________________________61________________79____85_________________________________      
 3etw(A) : AASLVGELQALDAEYQNLANQEEARFNEERAQADAARQALAQNEQVYNELSQRAQRLQAEANTRFYKSQYQELASKYEDALKKLEAEMEQQKAVISDFEKIQALRAGNL******      
         :                                                                                                                          
 3etz(B) : AASLVGELQALDAEYQNLANQEEARFNEERAQADAARQALAQNEQVYNELSQRAQRLQAEANTRFYKSQYQEAASKYEDALKKLEAEMEQQKAVISDFEKIQALRAGNLEHHHHH      
           ________________________________________________________61________________79____85_________________________________      

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		8.9
Translation
(A) 		0.0
Closure
(%) 		2.4
Bending Residues
( green ) 		  61 - 66
  79 - 82
  85 - 86
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download