Agap010489-Pa

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Agap010489-Pa
  Conformer 1
(PDB) 		8c68 (A)
  Conformer 2
(PDB) 		8c6g (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 92 0.89   12 - 73   94 - 123
2 20 0.42   74 - 93

Sequence


           ______________________________________________________________________73__________________93____________________________ 
 8c68(A) : *******NSMDMMRQACAPKFKVEEAELHGLRKSIFPANPDKELKCYAMCIAQMAGTMTKKGEISFSKTMAQIEAMLPPEMKTMAKEALTHCKDTQTSYKDPCDKAYFSAKCAADFTPDT 
         :                                                                                                                          
 8c6g(B) : MTMKQLTNSMDMMRQACAPKFKVEEAELHGLRKSIFPANPDKELKCYAMCIAQMAGTMTKKGEISFSKTMAQIEAMLPPEMKTMAKEALTHCKDTQTSYKDPCDKAYFSAKCAADFTPDT 
           ______________________________________________________________________73__________________93____________________________ 

           ____                                                                                                                     
 8c68(A) : FMFP                                                                                                                     
         :                                                                                                                          
 8c6g(B) : FMFP                                                                                                                     
           ____                                                                                                                     

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		12.5
Translation
(A) 		-0.2
Closure
(%) 		27.6
Bending Residues
( green ) 		  73 - 74
  93 - 94
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Mixed

PyMOL Script

Download and extract PyMOL PML script file Download