Antibody C57, Heavy Chain

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Antibody C57, Heavy Chain
  Conformer 1
(PDB) 		6xxv (A)
  Conformer 2
(PDB) 		3u9u (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 114 2.82   16 - 140
2 91 2.47   141 - 237

Sequence


           ________________________________________________________________________________________________________________________ 
 6xxv(A) : *VQLVESGGGLAKPGGSLRLSCAASGFTFSPYWMY--WVRQAPGKGLEWVSVINSGGGITYYTDSVKGRFTISRENAKNTLYLQMDSLRPEDTAVYYCVR--DRTYYSGVYYTEDGLDSW 
         :                                                                                                                          
 3u9u(A) : QVTLKESGPGILQPSQTLSLTCSFSGFSLSTYGIGVGWIRQPSGKGLEWLAHIWWNDN-KYYNIALRSRLTISKDTSNNQVFLKIASVDTADTATYYCARIPDDHYF----------DYW 
           ________________________________________________________________________________________________________________________ 

           _________140________________________________________________________________________________________________________     
 6xxv(A) : GQGVLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK*****     
         :                                                                                                                          
 3u9u(A) : GQGTTLTVSSAKTTAPSVYPLAPVCsSVT-----LGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSD-LYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIK     
           _________121________________________________________________________________________________________________________     

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		34.2
Translation
(A) 		-0.4
Closure
(%) 		98.5
Bending Residues
( green ) 		  140 - 141
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download