Anti-Cd33 Conditional Scfv

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Anti-Cd33 Conditional Scfv
  Conformer 1
(PDB) 		6uy3 (A)
  Conformer 2
(PDB) 		7dk0 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 67 12.38   143 - 204   219 - 225
2 114 1.93   4 - 118
3 23 8.98   205 - 218   226 - 234

Sequence


           ________________________________________________________________________________________________________________________ 
 6uy3(A) : *VQLVESGGGLVQAGGSLRLSCAASRRSSRSWAMHWVRQAPGKGLEWVA-VISYDGRLKYYADSVKGRFTISRDNAEYLVYLQMNSLRAEDTAVYYCAAEEGDGG------FFDYWGQGT 
         :                                                                                                                          
 7dk0(A) : EVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGRIIPIFGS-SNYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCAESPLGGGSGYSVSWFDPWGQGT 
           ________________________________________________________________________________________________________________________ 

           __118______________________________________________________________203____________218____225____________________________ 
 6uy3(A) : LVTVSSGsVLTQPPSASG-TP-GQRVTISCSGSSSNIGSNYVNWYQQLPGTAPKLLIYRNNERPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCAAWDGSLSGRGVFGTGTKLTVLE 
         :                                                                                                                          
 7dk0(A) : LVTVSSAS--TKGPSVFPLAPSgGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS*************** 
           __124______________________________________________________________192____________207____214____________________________ 

           ______                                                                                                                   
 6uy3(A) : NLYFQG                                                                                                                   
         :                                                                                                                          
 7dk0(A) : ******                                                                                                                   
           ______                                                                                                                   

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		86.7
Translation
(A) 		-16.5
Closure
(%) 		76.6
Bending Residues
( green ) 		  118 - 143
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		114.3
Translation
(A) 		5.3
Closure
(%) 		99.5
Bending Residues
( green ) 		  203 - 205
  218 - 219
  225 - 226
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Shear

Chart image not calculated - the graph is too big to count connection types.

PyMOL Script

Download and extract PyMOL PML script file Download