Beta-1,3-1,4-Glucanase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Beta-1,3-1,4-Glucanase
  Conformer 1
(PDB) 		3wdx (B)
  Conformer 2
(PDB) 		3wdt (C)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 259 0.24   2 - 102   107 - 110   113 - 129   133 - 136   140 - 151   166 - 226   231 - 232   237 - 294
2 34 0.45   103 - 106   111 - 112   130 - 132   137 - 139   152 - 165   227 - 230   233 - 236

Sequence


           _____________________________________________________________________________________________________102_106____________ 
 3wdx(B) : EFYHLVDDYGRGNGFFDKFNFFTGDDPTHGYVDYVSRDVAAGAGLIGERDGRTYMGVDFTNPASGRGRRSVRLESKNTYEHGLIVIDLAHMPGSVCGTWPAFWTLGTGDWPYGGAIDIIE 
         :                                                                                                                          
 3wdt(C) : *FYHLVDDYGRGNGFFDKFNFFTGDDPTHGYVDYVSRDVAAGAGLIGERDGRTYMGVDFTNPASGRGRRSVRLESKNTYEHGLIVIDLAHMPGSVCGTWPAFWTLGTGDWPYGGEIDIIE 
           _____________________________________________________________________________________________________102_106____________ 

           ________129___________________151___________165__________________________________________________________226_230___236__ 
 3wdx(B) : GVNDNTFNHMVLHTSDGCTIDNDGFTGNLKTSNCYVYAPGQDANAGCGIEATDPNSYGKGFNSIGGGIYATEITPNGISIWFFPRGSEPGDVLGDNPNPANWDTPAAKFAGGGCDWEGKF 
         :                                                                                                                          
 3wdt(C) : GVNDNTFNHMVLHTSDGCTIDNDGFTGNLKTSNCYVYAPGQDANAGCGIEATDPNSYGKGFNSIGGGIYATEITPNGISIWFFPRGSEPGDVLGDNPNPANWDTPAAKFAGGGCDWEGKF 
           ________129___________________151___________165__________________________________________________________226_230___236__ 

           __________________________________________________________                                                               
 3wdx(B) : NAQRLIFDVTFCGDWAGNVWGIGGCASRAANCVDFVRDNPSAFAESYWLVNSLRVYAP                                                               
         :                                                                                                                          
 3wdt(C) : NAQRLIFDVTFCGDWAGNVWGIGGCASRAANCVDFVRDNPSAFAESYWLVNSLRVYAP                                                               
           __________________________________________________________                                                               

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		3.7
Translation
(A) 		-0.1
Closure
(%) 		19.2
Bending Residues
( green ) 		  102 - 103
  106 - 113
  129 - 130
  132 - 148
  151 - 152
  165 - 166
  226 - 227
  230 - 233
  236 - 237
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download