Beta-1,3-1,4-Glucanase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Beta-1,3-1,4-Glucanase
  Conformer 1
(PDB) 		3wdy (A)
  Conformer 2
(PDB) 		3wdt (D)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 230 0.46   5 - 79   83 - 110   112 - 112   115 - 125   138 - 147   169 - 186   192 - 196   199 - 225   235 - 237   243 - 294
2 60 0.37   80 - 82   111 - 111   113 - 114   126 - 137   148 - 168   187 - 191   197 - 198   226 - 234   238 - 242

Sequence


           ______________________________________________________________________________79_82_________________________110_________ 
 3wdy(A) : *YHLVDDYGRGNGFFDKFNFFTGDDPTHGYVDYVSRDVAAGAGLIGERDGRTYMGVDFTNPASGRGRRSVRLESKNTYEHGLIVIDLAHMPGSVCGTWPAFWTLGTGDWPYGGAIDIIEG 
         :                                                                                                                          
 3wdt(D) : FYHLVDDYGRGNGFFDKFNFFTGDDPTHGYVDYVSRDVAAGAGLIGERDGRTYMGVDFTNPASGRGRRSVRLESKNTYEHGLIVIDLAHMPGSVCGTWPAFWTLGTGDWPYGGEIDIIEG 
           ______________________________________________________________________________79_82_________________________110_________ 

           ___125_________137______146___________________168_______________186__191__196__________________________225______234_____ 
 3wdy(A) : VNDNTFNHMVLHTSDGCTIDNDGFTGNLKTSNCYVYAPGQDANAGCGIEATDPNSYGKGFNSIGGGIYATEITPNGISIWFFPRGSEPGDVLGDNPNPANWDTPAAKFAGGGCDWEGKFN 
         :                                                                                                                          
 3wdt(D) : VNDNTFNHMVLHTSDGCTIDNDGFTGNLKTSNCYVYAPGQDANAGCGIEATDPNSYGKGFNSIGGGIYATEITPNGISIWFFPRGSEPGDVLGDNPNPANWDTPAAKFAGGGCDWEGKFN 
           ___125_________137______146___________________168_______________186__191__196__________________________225______234_____ 

           242______________________________________________________                                                                
 3wdy(A) : AQRLIFDVTFCGDWAGNVWGIGGCASRAANCVDFVRDNPSAFAESYWLVNSLRVYAP                                                                
         :                                                                                                                          
 3wdt(D) : AQRLIFDVTFCGDWAGNVWGIGGCASRAANCVDFVRDNPSAFAESYWLVNSLRVYAP                                                                
           242______________________________________________________                                                                

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		3.9
Translation
(A) 		-0.1
Closure
(%) 		96.7
Bending Residues
( green ) 		  79 - 80
  82 - 83
  110 - 115
  125 - 126
  137 - 138
  146 - 148
  168 - 169
  186 - 187
  191 - 192
  196 - 199
  225 - 226
  234 - 235
  237 - 238
  242 - 243
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download