Beta-1,3-1,4-Glucanase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Beta-1,3-1,4-Glucanase
  Conformer 1
(PDB) 		3wdy (C)
  Conformer 2
(PDB) 		3wdt (D)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 220 0.4   5 - 79   81 - 104   116 - 125   142 - 146   169 - 186   192 - 192   194 - 224   235 - 237   242 - 294
2 67 0.41   80 - 80   105 - 115   126 - 141   147 - 168   187 - 191   193 - 193   225 - 234   238 - 241

Sequence


           ______________________________________________________________________________79______________________104________115____ 
 3wdy(C) : *YHLVDDYGRGNGFFDKFNFFTGDDPTHGYVDYVSRDVAAGAGLIGERDGRTYMGVDFTNPASGRGRRSVRLESKNTYEHGLIVIDLAHMPGSVCGTWPAFWTLGTGDWPYGGAIDIIEG 
         :                                                                                                                          
 3wdt(D) : FYHLVDDYGRGNGFFDKFNFFTGDDPTHGYVDYVSRDVAAGAGLIGERDGRTYMGVDFTNPASGRGRRSVRLESKNTYEHGLIVIDLAHMPGSVCGTWPAFWTLGTGDWPYGGEIDIIEG 
           ______________________________________________________________________________79______________________104________115____ 

           ___125_____________141__146___________________168_______________186__191______________________________224_______234____2 
 3wdy(C) : VNDNTFNHMVLHTSDGCTIDNDGFTGNLKTSNCYVYAP---aNAGCGIEATDPNSYGKGFNSIGGGIYATEITPNGISIWFFPRGSEPGDVLGDNPNPANWDTPAAKFAGGGCDWEGKFN 
         :                                                                                                                          
 3wdt(D) : VNDNTFNHMVLHTSDGCTIDNDGFTGNLKTSNCYVYAPGQDANAGCGIEATDPNSYGKGFNSIGGGIYATEITPNGISIWFFPRGSEPGDVLGDNPNPANWDTPAAKFAGGGCDWEGKFN 
           ___125_____________141__146___________________168_______________186__191______________________________224_______234____2 

           41_______________________________________________________                                                                
 3wdy(C) : AQRLIFDVTFCGDWAGNVWGIGGCASRAANCVDFVRDNPSAFAESYWLVNSLRVYAP                                                                
         :                                                                                                                          
 3wdt(D) : AQRLIFDVTFCGDWAGNVWGIGGCASRAANCVDFVRDNPSAFAESYWLVNSLRVYAP                                                                
           41_______________________________________________________                                                                

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		4.8
Translation
(A) 		0.0
Closure
(%) 		97.4
Bending Residues
( green ) 		  79 - 81
  104 - 105
  115 - 116
  125 - 126
  141 - 142
  146 - 147
  168 - 169
  186 - 187
  191 - 195
  224 - 225
  234 - 235
  237 - 238
  241 - 242
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download