Beta-1,3-1,4-Glucanase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Beta-1,3-1,4-Glucanase
  Conformer 1
(PDB) 		3wdy (D)
  Conformer 2
(PDB) 		3wdt (D)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 242 0.49   3 - 79   82 - 112   116 - 125   139 - 147   161 - 162   167 - 188   192 - 226   234 - 237   243 - 294
2 50 0.27   80 - 81   113 - 115   126 - 138   148 - 160   163 - 166   189 - 191   227 - 233   238 - 242

Sequence


           ______________________________________________________________________________79______________________________112_______ 
 3wdy(D) : *YHLVDDYGRGNGFFDKFNFFTGDDPTHGYVDYVSRDVAAGAGLIGERDGRTYMGVDFTNPASGRGRRSVRLESKNTYEHGLIVIDLAHMPGSVCGTWPAFWTLGTGDWPYGGAIDIIEG 
         :                                                                                                                          
 3wdt(D) : FYHLVDDYGRGNGFFDKFNFFTGDDPTHGYVDYVSRDVAAGAGLIGERDGRTYMGVDFTNPASGRGRRSVRLESKNTYEHGLIVIDLAHMPGSVCGTWPAFWTLGTGDWPYGGEIDIIEG 
           ______________________________________________________________________________79______________________________112_______ 

           ___125__________138______147__________160___166___________________188___________________________________226____233_237__ 
 3wdy(D) : VNDNTFNHMVLHTSDGCTIDNDGFTGNLKTSNCYVYAPGQDANAGCGIEATDPNSYGKGFNSIGGGIYATEITPNGISIWFFPRGSEPGDVLGDNPNPANWDTPAAKFAGGGCDWEGKFN 
         :                                                                                                                          
 3wdt(D) : VNDNTFNHMVLHTSDGCTIDNDGFTGNLKTSNCYVYAPGQDANAGCGIEATDPNSYGKGFNSIGGGIYATEITPNGISIWFFPRGSEPGDVLGDNPNPANWDTPAAKFAGGGCDWEGKFN 
           ___125__________138______147__________160___166___________________188___________________________________226____233_237__ 

           242______________________________________________________                                                                
 3wdy(D) : AQRLIFDVTFCGDWAGNVWGIGGCASRAANCVDFVRDNPSAFAESYWLVNSLRVYAP                                                                
         :                                                                                                                          
 3wdt(D) : AQRLIFDVTFCGDWAGNVWGIGGCASRAANCVDFVRDNPSAFAESYWLVNSLRVYAP                                                                
           242______________________________________________________                                                                

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		3.4
Translation
(A) 		0.1
Closure
(%) 		88.5
Bending Residues
( green ) 		  79 - 82
  112 - 113
  115 - 116
  125 - 126
  138 - 139
  147 - 148
  160 - 163
  166 - 167
  188 - 189
  191 - 193
  226 - 227
  233 - 234
  237 - 238
  242 - 243
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download