Beta-1,3-1,4-Glucanase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Beta-1,3-1,4-Glucanase
  Conformer 1
(PDB) 		3wdt (D)
  Conformer 2
(PDB) 		3wdu (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 227 0.41   3 - 75   80 - 103   113 - 125   127 - 127   142 - 149   167 - 187   192 - 192   194 - 226   242 - 294
2 65 0.25   76 - 79   104 - 112   126 - 126   128 - 141   150 - 166   188 - 191   193 - 193   227 - 241

Sequence


           __________________________________________________________________________75__79_____________________103______112_______ 
 3wdt(D) : FYHLVDDYGRGNGFFDKFNFFTGDDPTHGYVDYVSRDVAAGAGLIGERDGRTYMGVDFTNPASGRGRRSVRLESKNTYEHGLIVIDLAHMPGSVCGTWPAFWTLGTGDWPYGGEIDIIEG 
         :                                                                                                                          
 3wdu(A) : *YHLVDDYGRGNGFFDKFNFFTGDDPTHGYVDYVSRDVAAGAGLIGERDGRTYMGVDFTNPASGRGRRSVRLESKNTYEHGLIVIDLAHMPGSVCGTWPAFWTLGTGDWPYGGEIDIIEG 
           __________________________________________________________________________75__79_____________________103______112_______ 

           ___125_____________141_____149______________166__________________187____________________________________226____________2 
 3wdt(D) : VNDNTFNHMVLHTSDGCTIDNDGFTGNLKTSNCYVYAPGQDANAGCGIEATDPNSYGKGFNSIGGGIYATEITPNGISIWFFPRGSEPGDVLGDNPNPANWDTPAAKFAGGGCDWEGKFN 
         :                                                                                                                          
 3wdu(A) : VNDNTFNHMVLHTSDGCTIDNDGFTGNLKTSNCYVYAPGQDANAGCGIEATDPNSYGKGFNSIGGGIYATEITPNGISIWFFPRGSEPGDVLGDNPNPANWDTPAAKFAGGGCDWEGKFN 
           ___125_____________141_____149______________166__________________187____________________________________226____________2 

           41_______________________________________________________                                                                
 3wdt(D) : AQRLIFDVTFCGDWAGNVWGIGGCASRAANCVDFVRDNPSAFAESYWLVNSLRVYAP                                                                
         :                                                                                                                          
 3wdu(A) : AQRLIFDVTFCGDWAGNVWGIGGCASRAANCVDFVRDNPSAFAESYWLVNSLRVYAP                                                                
           41_______________________________________________________                                                                

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		3.7
Translation
(A) 		0.1
Closure
(%) 		99.8
Bending Residues
( green ) 		  75 - 76
  79 - 80
  103 - 104
  112 - 113
  125 - 128
  141 - 142
  149 - 150
  166 - 167
  187 - 194
  226 - 227
  241 - 242
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download