Calmodulin

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Calmodulin
  Conformer 1
(PDB) 		1clm (A)
  Conformer 2
(PDB) 		1iq5 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 76 1.28   6 - 81
2 64 0.78   82 - 145

Sequence


           _________________________________________________________________________78_____________________________________________ 
 1clm(A) : LTEEQIAEFKEAFALFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLSLMARKMKEQDSEEELIEAFKVFDRDGNGLISAAELRHVMTNLGEKLTDDEVDE 
         :                                                                                                                          
 1iq5(A) : LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDE 
           _________________________________________________________________________78_____________________________________________ 

           ________________________                                                                                                 
 1clm(A) : MIREADIDGDGHINYEEFVRMMVS                                                                                                 
         :                                                                                                                          
 1iq5(A) : MIREADIDGDGQVNYEEFVQMMTA                                                                                                 
           ________________________                                                                                                 

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		131.4
Translation
(A) 		-4.5
Closure
(%) 		92.4
Bending Residues
( green ) 		  78 - 82
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download