Calmodulin

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Calmodulin
  Conformer 1
(PDB) 		1cll (A)
  Conformer 2
(PDB) 		1prw (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 26 0.92   6 - 16   64 - 78
2 47 0.91   17 - 63
3 66 1.17   79 - 145

Sequence


           ______________16_____________________________________________63____________77___________________________________________ 
 1cll(A) : ***LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEE 
         :                                                                                                                          
 1prw(A) : ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGE-lTDEE 
           ______________16_____________________________________________63____________77___________________________________________ 

           ____________________________                                                                                             
 1cll(A) : VDEMIREADIDGDGQVNYEEFVQMMTA*                                                                                             
         :                                                                                                                          
 1prw(A) : VDEMIREADIDGDGQVNYEEFVQMMTAK                                                                                             
           ____________________________                                                                                             

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		32.9
Translation
(A) 		0.5
Closure
(%) 		98.8
Bending Residues
( green ) 		  16 - 18
  63 - 64
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		166.6
Translation
(A) 		-2.3
Closure
(%) 		86.7
Bending Residues
( green ) 		  77 - 81
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download