Calmodulin

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Calmodulin
  Conformer 1
(PDB) 		1cfd (A)
  Conformer 2
(PDB) 		1prw (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 36 1.8   81 - 101   132 - 146
2 78 3.23   3 - 80
3 29 2.52   102 - 131

Sequence


           ___________________________________________________________________________77_____________________101___________________ 
 1cfd(A) : ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEE 
         :                                                                                                                          
 1prw(A) : ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGE-lTDEE 
           ___________________________________________________________________________77_____________________101___________________ 

           _____128____________________                                                                                             
 1cfd(A) : VDEMIREADIDGDGQVNYEEFVQMMTAK                                                                                             
         :                                                                                                                          
 1prw(A) : VDEMIREADIDGDGQVNYEEFVQMMTAK                                                                                             
           _____128____________________                                                                                             

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		94.4
Translation
(A) 		-9.0
Closure
(%) 		89.2
Bending Residues
( green ) 		  77 - 81
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		61.9
Translation
(A) 		3.7
Closure
(%) 		73.8
Bending Residues
( green ) 		  101 - 102
  128 - 133
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download