Calmodulin

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Calmodulin
  Conformer 1
(PDB) 		1cfd (A)
  Conformer 2
(PDB) 		1exr (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 25 1.05   81 - 100   132 - 136
2 76 4.46   4 - 79
3 38 3.74   101 - 129   137 - 145

Sequence


           _____________________________________________________________________________79__________________100____________________ 
 1cfd(A) : ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEE 
         :                                                                                                                          
 1exr(A) : *EQLTEEQIAEFKEAFALFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLSLMARKMKEQDSEEELIEAFKVFDRDGNGLISAAELRHVMTNLGEKLTDDE 
           _____________________________________________________________________________79__________________100____________________ 

           _____128_____136____________                                                                                             
 1cfd(A) : VDEMIREADIDGDGQVNYEEFVQMMTAK                                                                                             
         :                                                                                                                          
 1exr(A) : VDEMIREADIDGDGHINYEEFVRMMVS*                                                                                             
           _____128_____136____________                                                                                             

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		127.2
Translation
(A) 		-0.4
Closure
(%) 		27.6
Bending Residues
( green ) 		  79 - 81
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		49.2
Translation
(A) 		1.7
Closure
(%) 		87.0
Bending Residues
( green ) 		  100 - 101
  128 - 133
  136 - 138
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download