Calmodulin

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Calmodulin
  Conformer 1
(PDB)
1dmo (A)
  Conformer 2
(PDB)
1cll (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 41 2.11   6 - 28   57 - 60   62 - 75
2 29 1.84   29 - 56   61 - 61
3 24 1.72   81 - 100   135 - 137   145 - 145
4 41 3.87   101 - 134   138 - 144

Sequence


           __________________________28__________________________56__60_____________75______________________100____________________ 
 1dmo(A) : ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEE 
         :                                                                                                                          
 1cll(A) : ***LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEE 
           __________________________28__________________________56__60_____________75______________________100____________________ 

           ___________134______143_____                                                                                             
 1dmo(A) : VDEMIREANIDGDGQVNYEEFVQMMTAK                                                                                             
         :                                                                                                                          
 1cll(A) : VDEMIREADIDGDGQVNYEEFVQMMTA*                                                                                             
           ___________134______143_____                                                                                             

Morph

Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Fixed Domain Moving Domain Rotation Angle Translation   (A) Closure Bending Residues  
1 2 60.1 2.8 83.2   28 - 30   56 - 57   60 - 62 Bending Region Analysis
1 3 153.7 1.4 81.3   75 - 81 Bending Region Analysis
4 3 58.7 -0.3 40.5   100 - 101   134 - 138   143 - 145 Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 4 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 4

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download