Calmodulin

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Calmodulin
  Conformer 1
(PDB) 		1g4y (R)
  Conformer 2
(PDB) 		1iq5 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 71 1.16   6 - 76
2 56 2.52   81 - 136

Sequence


           _________________________________________________________________________75_____________________________________________ 
 1g4y(R) : ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEE 
         :                                                                                                                          
 1iq5(A) : ***LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEE 
           _________________________________________________________________________75_____________________________________________ 

           ___________________________                                                                                              
 1g4y(R) : VDEMIREADIDGDGQVNYEEFVQMMTA                                                                                              
         :                                                                                                                          
 1iq5(A) : VDEMIREADIDGDGQVNYEEFVQMMTA                                                                                              
           ___________________________                                                                                              

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		39.3
Translation
(A) 		-11.5
Closure
(%) 		32.2
Bending Residues
( green ) 		  75 - 81
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download