Calmodulin

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Calmodulin
  Conformer 1
(PDB) 		1cll (A)
  Conformer 2
(PDB) 		3gn4 (D)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 27 1.19   81 - 100   130 - 136
2 46 2.29   6 - 27   57 - 80
3 38 2.91   101 - 129   137 - 145
4 29 1.56   28 - 56

Sequence


           _______________________27___________________________56____________________78___________________100______________________ 
 1cll(A) : *LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVD 
         :                                                                                                                          
 3gn4(D) : QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVD 
           _______________________27___________________________56____________________78___________________100______________________ 

           ____129____136___________                                                                                                
 1cll(A) : EMIREADIDGDGQVNYEEFVQMMTA                                                                                                
         :                                                                                                                          
 3gn4(D) : EMIREADIDGDGQVNYEEFVTMMTS                                                                                                
           ____129____136___________                                                                                                

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Fixed Domain Moving Domain Rotation Angle Translation   (A) Closure Bending Residues  
1 2 119.4 3.9 34.2   78 - 83 Bending Region Analysis
1 3 35.2 1.0 97.9   100 - 101   129 - 130   136 - 137 Bending Region Analysis
4 2 59.0 3.6 99.5   27 - 30   56 - 60 Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 4 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 4

Movement classification:

No Contacts
PANTOTHENATE KINASE

PyMOL Script

Download and extract PyMOL PML script file Download