Calmodulin

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Calmodulin
  Conformer 1
(PDB) 		1cll (A)
  Conformer 2
(PDB) 		1cfd (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 34 1.98   81 - 100   132 - 145
2 43 2.1   6 - 28   57 - 76
3 28 2.38   101 - 128
4 28 1.2   29 - 56

Sequence


           __________________________28__________________________56__________________76_____________________100____________________ 
 1cll(A) : ***LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEE 
         :                                                                                                                          
 1cfd(A) : ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEE 
           __________________________28__________________________56__________________76_____________________100____________________ 

           _____128____________________                                                                                             
 1cll(A) : VDEMIREADIDGDGQVNYEEFVQMMTA*                                                                                             
         :                                                                                                                          
 1cfd(A) : VDEMIREADIDGDGQVNYEEFVQMMTAK                                                                                             
           _____128____________________                                                                                             

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Fixed Domain Moving Domain Rotation Angle Translation   (A) Closure Bending Residues  
1 2 127.0 1.4 28.1   76 - 81 Bending Region Analysis
1 3 58.5 3.5 99.8   100 - 101   128 - 134 Bending Region Analysis
4 2 53.9 3.1 99.2   28 - 31   56 - 57 Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 4 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 4

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download