Cap228-16h Heavy Chain

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Cap228-16h Heavy Chain
  Conformer 1
(PDB) 		6fy2 (H)
  Conformer 2
(PDB) 		4qth (H)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 122 1.31   3 - 115
2 90 2.78   116 - 213

Sequence


           ________________________________________________________________________________________________________________________ 
 6fy2(H) : EVQLVQSGAEVKKPGESLKISCKGSGYRFPSSWIGWVRQVPGKGLEWMGIIYPGDGETRYRASFQGQVTISADQSSNTAYLQWSSLKASDTAMYYCARHGRGVREVINAFDIWGQGTMVT 
         :                                                                                                                          
 4qth(H) : QVQLQQSGAELMKPGASVKLSCKAAGYTFTAYWIEWIRQRPGHGLEWIGEILPGSSSTNCNEMFKGKATFTADTSSNSAYMQLSSLTTEDSAIYYCTRDFSGDRSNLY-FDVWGTGTTVT 
           ________________________________________________________________________________________________________________________ 

           __115______________________________________________________________________________________________________              
 6fy2(H) : VSSASTKGPSVFPLAPSgTAA-------LGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS*              
         :                                                                                                                          
 4qth(H) : VSSAKTTPPSVYPLAP-GSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSD-LYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC              
           __124______________________________________________________________________________________________________              

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		29.8
Translation
(A) 		0.0
Closure
(%) 		88.4
Bending Residues
( green ) 		  115 - 116
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download