Cap228-16h Heavy Chain

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Cap228-16h Heavy Chain
  Conformer 1
(PDB) 		6fy2 (H)
  Conformer 2
(PDB) 		8sip (H)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 118 2.01   4 - 113   169 - 169   176 - 176
2 89 0.99   114 - 168   170 - 175   177 - 211

Sequence


           ________________________________________________________________________________________________________________________ 
 6fy2(H) : EVQLVQSGAEVKKPGESLKISCKGSGYRFPSSWIGWVRQVPGKGLEWMGIIYPGDGETRYRASFQGQVTISADQSSNTAYLQWSSLKASDTAMYYCARHGRGVREVINAFDIWGQGTMVT 
         :                                                                                                                          
 8sip(H) : *IQLVQSGPELKKPGETVKISCKASGYTFTNFGMNWVKQAPGKGLKWMGWIKTYTGEPIYVDDFKGRFAFSLETSASTAYLQINTLKNEDTATYFCAR-GRPEGYVL---DYWGQGTSVT 
           ________________________________________________________________________________________________________________________ 

           113______________________________________________168_______________________________________________                      
 6fy2(H) : VSSASTKGPSVFPLAPSgTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS                      
         :                                                                                                                          
 8sip(H) : VSSAKTTPPSVYPLAPGsMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSD-LYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP**                      
           119______________________________________________174_______________________________________________                      

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		21.8
Translation
(A) 		-0.9
Closure
(%) 		92.9
Bending Residues
( green ) 		  113 - 114
  168 - 177
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download