Cr1-28 Fab Heavy Chain

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Cr1-28 Fab Heavy Chain
  Conformer 1
(PDB) 		5w1k (L)
  Conformer 2
(PDB) 		6c08 (D)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 119 2.49   3 - 10   12 - 129
2 91 1.34   11 - 11   130 - 224

Sequence


           ________9_______________________________________________________________________________________________________________ 
 5w1k(L) : QVQLVESGGGVVQPGRSLRLSCAASGFTFSSSAMHWVRQAPGKGLEWVAVIWSDGSNENYADSVKGRFTISRDNSKNTLYLQMSSLRAEDTAVYYCATDKTYVSGYTSTWYYFNYWGQGT 
         :                                                                                                                          
 6c08(D) : QIQLVQSGPKLSKPGGTDKISSKASGYSFTDYVMNWVKAGPGKGLEWNGSINTSNGYTTYISAFKGRGSFSVDSSASTAAQQLSVLKAAATAVYFNARN---FRGNGA----MDYWGQGT 
           ________9_______________________________________________________________________________________________________________ 

           ______129_________________________________________________________________________________________________               
 5w1k(L) : LVTVSGASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP               
         :                                                                                                                          
 6c08(D) : SVTVSSAKTTAPSVYPLEVSt----GSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVL-ASDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP               
           ______122_________________________________________________________________________________________________               

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		23.8
Translation
(A) 		1.4
Closure
(%) 		97.0
Bending Residues
( green ) 		  9 - 12
  129 - 130
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download