Cyclophilin

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Cyclophilin
  Conformer 1
(PDB) 		2haq (A)
  Conformer 2
(PDB) 		3bt8 (A)
  Window Length 9
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 122 0.37   26 - 104   121 - 123   130 - 135   150 - 183
2 36 0.3   105 - 120   124 - 129   136 - 149

Sequence


           ______________________________________________________________________________102_______________120______129___135______ 
 2haq(A) : EPEVTAKVYFDVMIDSEPLGRITIGLFGKDAPLTTENFRQLCTGEHGFGYKDSIFHRVIQNFMIQGGDFTNFDGTGGKSIYGEKFADENLNVKHFVGALSMANAGPNTNGSQFFITTAPT 
         :                                                                                                                          
 3bt8(A) : EPEVTAKVYFDVMIDSEPLGRITIGLFGKDAPLTTENFRQLCTGEHGFGYKDSIFHRVIQNFMIQGGDFTNFDGTGGKSIYGEKFADENLNVKHFVGALSMANAGPNTNGSQFFITTAPT 
           ______________________________________________________________________________102_______________120______129___135______ 

           _____149______________________________________                                                                           
 2haq(A) : PWLDGRHVVFGKVLDGMDVVLRIEKTKTNSHDRPVKPVKIVASGEL                                                                           
         :                                                                                                                          
 3bt8(A) : PWLDGAHVVFGKVLDGMDVVLRIEKTKTNSHDRPVKPVKIVASGEL                                                                           
           _____149______________________________________                                                                           

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		4.5
Translation
(A) 		-0.1
Closure
(%) 		38.2
Bending Residues
( green ) 		  102 - 105
  120 - 121
  123 - 124
  129 - 130
  135 - 137
  149 - 150
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download