Engineered Retroaldolase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Engineered Retroaldolase
  Conformer 1
(PDB) 		7f1l (A)
  Conformer 2
(PDB) 		7f1h (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 151 0.41   3 - 78   81 - 85   89 - 99   101 - 102   106 - 117   137 - 166   172 - 186
2 33 0.31   79 - 80   86 - 88   100 - 100   103 - 105   118 - 136   167 - 171

Sequence


           ________________________________________________________________________________78_____85_88_________99___105_________11 
 7f1l(A) : GSHMDTTITQNQTGYDNGYFYSFWTDAPGTVSMTLHSGGSYSTSWRNTGHFKAGKGWSTGGRRTVTYNASFNPSGDAYLTLYGWTRNPLVSYLIVESWGTYRPTGTYKGTVTTDGGTYDI 
         :                                                                                                                          
 7f1h(A) : ****DTTITQNQTGYDNGYFYSFWTDAPGTVSMTLHSGGSYSTSWRNTGHFKAGKGWSTGGRRTVTYNASFNPSGDAYLTLYGWTRNPLVSYLIVESWGTYRPTGTYKGTVTTDGGTYDI 
           ________________________________________________________________________________78_____85_88_________99___105_________11 

           7________________136___________________________166_170____________________                                               
 7f1l(A) : YETWRYNAPSIEGTRTFQIFWSVRQQKRTSGTITIGNHFDAWARAGMNLGSHDYQIMATKGWQSSGSSTVSISE                                               
         :                                                                                                                          
 7f1h(A) : YETWRYNAPSIEGTRTFQIFWSVRQQKRTSGTITIGNHFDAWARAGMNLGSHDYQIMATKGWQSSGSSTVSIS*                                               
           7________________136___________________________166_170____________________                                               

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		6.3
Translation
(A) 		0.1
Closure
(%) 		100.0
Bending Residues
( green ) 		  78 - 81
  85 - 86
  88 - 89
  99 - 103
  105 - 106
  117 - 118
  136 - 137
  166 - 167
  170 - 172
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Mixed

PyMOL Script

Download and extract PyMOL PML script file Download