Fab Heavy Chain

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Fab Heavy Chain
  Conformer 1
(PDB) 		4hzl (H)
  Conformer 2
(PDB) 		8onk (H)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 118 2.36   3 - 122
2 91 0.61   123 - 220

Sequence


           _______________________________________________________________________________________________________________________1 
 4hzl(H) : EVMLVESGGDLVKPGGSLKLPCAASGFTVSTYAMSWIRQTPEKRLEWVATISSGGSYTYYPDNVKGRFTISRDIAKNTLYLQMSSLRSEDTAMYYCARHPPTVVAGDAMDYWGQGTSVTV 
         :                                                                                                                          
 8onk(H) : EVRLQQSGPELVKPGASLKISCKASGYTFTDYNIHWLRQSHSKSLEWIGSIYPYNGRPGYNQKFKNKTTLTVDNSSSTAYMELRGLTSDDSAVYFCARSR-SYYNG-SRDYWGQGTSLTV 
           _______________________________________________________________________________________________________________________1 

           22________________________________________________________________________________________________                       
 4hzl(H) : SSAKTTPPSVYPLAPGSsMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR*                       
         :                                                                                                                          
 8onk(H) : SSAKTTPPSVYPLAP--sMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD                       
           20________________________________________________________________________________________________                       

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		19.7
Translation
(A) 		-1.7
Closure
(%) 		87.5
Bending Residues
( green ) 		  122 - 123
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download