Fibronectin

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Fibronectin
  Conformer 1
(PDB) 		1e8b (A)
  Conformer 2
(PDB) 		1e88 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 99 1.03   3 - 44   102 - 158
2 57 0.92   45 - 101

Sequence


           __________________________________________44_____________________________________________________100____________________ 
 1e8b(A) : YGHCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPCVLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALCHFPF 
         :                                                                                                                          
 1e88(A) : YGHCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPCVLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALCHFPF 
           __________________________________________44_____________________________________________________100____________________ 

           ________________________________________                                                                                 
 1e8b(A) : LYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMA                                                                                 
         :                                                                                                                          
 1e88(A) : LYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMA                                                                                 
           ________________________________________                                                                                 

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		40.4
Translation
(A) 		-0.4
Closure
(%) 		45.0
Bending Residues
( green ) 		  44 - 45
  100 - 102
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download