Gamma Crystallin D

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Gamma Crystallin D
  Conformer 1
(PDB) 		1hk0 (X)
  Conformer 2
(PDB) 		2klj (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 86 0.96   82 - 140   144 - 171
2 83 0.98   3 - 81   141 - 143   172 - 172

Sequence


           ________________________________________________________________________________81______________________________________ 
 1hk0(X) : *GKITLYEDRGFQGRHYECSSDHPNLQPYLSRCNSARVDSGCWMLYEQPNYSGLQYFLRRGDYADHQQWMGLSDSVRSCRLIPHSGSHRIRLYEREDYRGQMIEFTEDCSCLQDRFRFNE 
         :                                                                                                                          
 2klj(A) : QGKITLYEDRGFQGRHYECSSDHTNLQPYLSRCNSARVDSGCWMLYEQPNYSGLQYFLRRGDYADHQQWMGLSDSVRSCRLIPHSGSHRIRLYEREDYRGQMIEFTEDCSCLQDRFRFNE 
           ________________________________________________________________________________82______________________________________ 

           _________________140__________________________169_____                                                                   
 1hk0(X) : IHSLNVLEGSWVLYELSNYRGRQYLLMPGDYRRYQDWGATNARVGSLRRVIDFS                                                                   
         :                                                                                                                          
 2klj(A) : IHSLNVLEGSWVLYELSNYRGRQYLLMPGDYRRYQDWGATNARVGSLRRVIDFS                                                                   
           _________________140__________________________169_____                                                                   

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		11.2
Translation
(A) 		0.3
Closure
(%) 		99.8
Bending Residues
( green ) 		  81 - 82
  140 - 141
  143 - 144
  169 - 172
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Mixed

PyMOL Script

Download and extract PyMOL PML script file Download