Heavy Chain Of The Monoclonal Antibody Fab Sya/j6

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Heavy Chain Of The Monoclonal Antibody Fab Sya/j6
  Conformer 1
(PDB) 		1m7i (B)
  Conformer 2
(PDB) 		7n4i (H)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 118 2.36   3 - 115
2 93 2.79   116 - 208

Sequence


           ________________________________________________________________________________________________________________________ 
 1m7i(B) : EVKVEESGGGLVQPGGSMKLSCVASGFTFSNYWMEWVRQSPEKGLEWVAEIRLKSNNYATHYAESVKGRFTISRDDSKSSVYLQMNNLRAEDTGIYYCTR---GGAVGAMDYWGQGTSVT 
         :                                                                                                                          
 7n4i(H) : EVQLVQSGAEVKKPGESLKISCKGSGYSFISYWIAWVRQMPGKGLEWMGIIY--PGDSDTTYSPSFQGQVTISADKSISTAYLQWSSLKASDTAIYYCARLLYYSDSSPLDSWGQGTLVT 
           ________________________________________________________________________________________________________________________ 

           __115_____________________________________________________________________________________________________               
 1m7i(B) : VSSATTTAPSVYPLVPGCSDTSGSSVTLGCLVKGYFPEPVTVKWNYGALSSGVRTVSSVLQS-GFYSLSSLVTVPSSTWPSQTVICNVAHPAS--KVDLIKEPSGP               
         :                                                                                                                          
 7n4i(H) : VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP***               
           __123_____________________________________________________________________________________________________               

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		54.8
Translation
(A) 		-3.0
Closure
(%) 		98.6
Bending Residues
( green ) 		  115 - 116
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download