Hypothetical Protein Ttha0113

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Hypothetical Protein Ttha0113
  Conformer 1
(PDB) 		2dp9 (A)
  Conformer 2
(PDB) 		2enu (A)
  Window Length 11
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 27 5.81   60 - 86
2 21 6.22   34 - 52   102 - 103

Sequence


           _____________________________________________________52_________________________________86______________________________ 
 2dp9(A) : MDYMERPKLGLIVREPYASLIVDGRKVWEIRRRKTRHRGPLGIVSGGRLIGQADL-VGVEGPFSVEELLAHQEKHLAEEAFLRAYAKDEPLYAWVLENAFRYEKPLHVPRRPGRVMFVDL 
         :                                                                                                                          
 2enu(A) : ******************************MELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQARRLKGALPSLPAFSSDLLRARRTAELAGFSPRLYPELREIHFGALEGALWETLDP 
           _____________________________________________________25_________________________________60______________________________ 

           _________________________________________________________________________________                                        
 2dp9(A) : SEVRW****************************************************************************                                        
         :                                                                                                                          
 2enu(A) : RYKEALLRFQGFHPPGGESLSAFQERVFRFMEGLKAPAVLFTHGGVVRAVLRALGEDGLVPPGSAVAVDWPRRVLVRLALD                                        
           _________________________________________________________________________________                                        

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		106.8
Translation
(A) 		16.3
Closure
(%) 		12.3
Bending Residues
( green ) 		  52 - 60
  86 - 103
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download