Invertase Inhibitor

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Invertase Inhibitor
  Conformer 1
(PDB) 		2cj4 (B)
  Conformer 2
(PDB) 		2cj5 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 98 0.29   47 - 144
2 44 0.28   7 - 46   145 - 148

Sequence


           _________________________________________46_____________________________________________________________________________ 
 2cj4(B) : *NLVETTCKNTPNYQLCLKTLLSDKRSATGDITTLALIMVDAIKAKANQAAVTISKLRHSNPPAAWKGPLKNCAFSYKVILTASLPEAIEALTKGDPKFAEDGMVGSSGDAQECEEYFKG 
         :                                                                                                                          
 2cj5(A) : NNLVETTCKNTPNYQLCLKTLLSDKRSATGDITTLALIMVDAIKAKANQAAVTISKLRHSNPPAAWKGPLKNCAFSYKVILTASLPEAIEALTKGDPKFAEDGMVGSSGDAQECEEYFKG 
           _________________________________________46_____________________________________________________________________________ 

           __________________144______                                                                                              
 2cj4(B) : SKSPFSALNIAVHELSDVGRAIVRNLL                                                                                              
         :                                                                                                                          
 2cj5(A) : SKSPFSALNIAVHELSDVGRAIVRNLL                                                                                              
           __________________144______                                                                                              

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		4.8
Translation
(A) 		0.1
Closure
(%) 		38.7
Bending Residues
( green ) 		  46 - 47
  144 - 145
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download