Invertase Inhibitor

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Invertase Inhibitor
  Conformer 1
(PDB) 		2cj4 (A)
  Conformer 2
(PDB) 		2cj8 (B)
  Window Length 7
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 116 0.62   8 - 58   66 - 112   129 - 146
2 23 0.91   59 - 65   113 - 128

Sequence


           ____________________________________________________57______65____________________________________________112___________ 
 2cj4(A) : NNLVETTCKNTPNYQLCLKTLLSDKRSATGDITTLALIMVDAIKAKANQAAVTISKLRHSNPPAAWKGPLKNCAFSYKVILTASLPEAIEALTKGDPKFAEDGMVGSSGDAQECEEYFKG 
         :                                                                                                                          
 2cj8(B) : *NLVETTCKNTPNYQLCLKTLLSDKRSATGDITTLALIMVDAIKAKANQAAVTISKLRHSNPPAAWKGPLKNCAFSYKVILTASLPEAIEALTKGDPKFAEDGMVGSSGDAQECEEYFKG 
           ____________________________________________________57______65____________________________________________112___________ 

           __128______________________                                                                                              
 2cj4(A) : SKSPFSALNIAVHELSDVGRAIVRNLL                                                                                              
         :                                                                                                                          
 2cj8(B) : SKSPFSALNIAVHELSDVGRAIVRNL*                                                                                              
           __128______________________                                                                                              

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		12.7
Translation
(A) 		0.1
Closure
(%) 		59.5
Bending Residues
( green ) 		  57 - 59
  65 - 66
  112 - 113
  128 - 130
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download