5-Methylcytosine-Specific Restriction Enzyme B

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name 5-Methylcytosine-Specific Restriction Enzyme B
  Conformer 1
(PDB) 		6hz4 (C)
  Conformer 2
(PDB) 		6hz4 (D)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 197 1.2   176 - 362   399 - 399   401 - 405   410 - 413
2 82 0.8   363 - 398   400 - 400   406 - 409   414 - 454

Sequence


           ________________________________________________________________________________________________________________________ 
 6hz4(C) : YCLEDALNDLFIPETTIETILKRLTIKKNIILQGPPGVGKTFVARRLAYLLTGEKAPQRVNMVQFHQSYSYEDFIQGYRPNGVGFRRKDGIFYNFCQQAKEQPEKKYIFIIDEINRANLS 
         :                                                                                                                          
 6hz4(D) : ******LNDLFIPETTIETILKRLTIKKNIILQGPPGVGKTFVARRLAYLLTGEKAPQRVNMVQFHQSYSYEDFIQGYRPNGVGFRRKDGIFYNFCQQAKEQPEKKYIFIIDEINRANLS 
           ________________________________________________________________________________________________________________________ 

           ________________________________________________________________________362______________________________395_______405_4 
 6hz4(C) : KVFGEVMMLMEHDKRGENWSVPLTYSENDEERFYVPENVYIIGLMNTADRSLAVVDYALRRRFSFIDIEPGFDTPQFRNFLLNKKAEPSFVESLCQKMNELNQEISKEATILGKGFRIGH 
         :                                                                                                                          
 6hz4(D) : KVFGEVMMLMEHDKRGENWSVPLTYSENDEERFYVPENVYIIGLMNTADRSLAVVDYALRRRFSFIDIEPGFDTPQFRNFLLNKKAEPSFVESLCQKMNELNQEISKEATILGKGFRIGH 
           ________________________________________________________________________362______________________________395_______405_4 

           09_413____________________________________________                                                                       
 6hz4(C) : SYFCCGLEDGTSPDTQWLNEIVMTDIAPLLEEYFFDDPYKQQKWTNKLLG                                                                       
         :                                                                                                                          
 6hz4(D) : SYFCCGLEDGTSPDTQWLNEIVMTDIAPLLEEYFFDDPYKQQKWTNKLLG                                                                       
           09_413____________________________________________                                                                       

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		9.3
Translation
(A) 		-0.2
Closure
(%) 		82.5
Bending Residues
( green ) 		  362 - 363
  395 - 401
  405 - 406
  409 - 410
  413 - 414
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Mixed

PyMOL Script

Download and extract PyMOL PML script file Download