5-Methylcytosine-Specific Restriction Enzyme B

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name 5-Methylcytosine-Specific Restriction Enzyme B
  Conformer 1
(PDB) 		6ut6 (E)
  Conformer 2
(PDB) 		6ut6 (F)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 203 1.17   167 - 173   179 - 368   399 - 404
2 85 0.89   174 - 178   369 - 398   405 - 454

Sequence


           ______173_______________________________________________________________________________________________________________ 
 6ut6(E) : TESYCLEDALNDLFIPETTIETILKRLTIKKNIILQGPPGVGKTFVARRLAYLLTGEKAPQRVNMVQFHQSYSYEDFIQGYRPNGVGFRRKDGIFYNFCQQAKEQPEKKYIFIIDEINRA 
         :                                                                                                                          
 6ut6(F) : TESYCLEDALNDLFIPETTIETILKRLTIKKNIILQGPPGVGKTFVARRLAYLLTGEKAPQRVNMVQFHQSYSYEDFIQGYRPNGVGFRRKDGIFYNFCQQAKEQPEKKYIFIIDEINRA 
           ______173_______________________________________________________________________________________________________________ 

           _________________________________________________________________________________368__________________________397____404 
 6ut6(E) : NLSKVFGEVMMLMEHDKRGENWSVPLTYSENDEERFYVPENVYIIGLMNTADRSLAVVDYALRRRFSFIDIEPGFDTPQFRNFLLNKKAEPSFVESLCQKMNELNQEISKEATILGKGFR 
         :                                                                                                                          
 6ut6(F) : NLSKVFGEVMMLMEHDKRGENWSVPLTYSENDEERFYVPENVYIIGLMNTADRSLAVVDYALRRRFSFIDIEPGFDTPQFRNFLLNKKAEPSFVESLCQKMNELNQEISKEATILGKGFR 
           _________________________________________________________________________________368__________________________397____404 

           ____________________________________________________                                                                     
 6ut6(E) : IGHSYFCCGLEDGTSPDTQWLNEIVMTDIAPLLEEYFFDDPYKQQKWTNKLL                                                                     
         :                                                                                                                          
 6ut6(F) : IGHSYFCCGLEDGTSPDTQWLNEIVMTDIAPLLEEYFFDDPYKQQKWTNKLL                                                                     
           ____________________________________________________                                                                     

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		11.1
Translation
(A) 		-0.3
Closure
(%) 		85.1
Bending Residues
( green ) 		  173 - 179
  368 - 369
  397 - 399
  404 - 405
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download