Monellin Chain B,monellin Chain A

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Monellin Chain B,monellin Chain A
  Conformer 1
(PDB) 		5xfu (D)
  Conformer 2
(PDB) 		7d75 (D)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 45 0.73   4 - 48
2 41 0.87   49 - 89

Sequence


           ____________________________________________47____________________________________________                               
 5xfu(D) : GEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYEIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP                               
         :                                                                                                                          
 7d75(D) : GEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYEDKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP                               
           ____________________________________________46____________________________________________                               

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		60.6
Translation
(A) 		-0.7
Closure
(%) 		2.3
Bending Residues
( green ) 		  47 - 51
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download