Pheromone-Binding Protein Asp1

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Pheromone-Binding Protein Asp1
  Conformer 1
(PDB) 		3cab (A)
  Conformer 2
(PDB) 		3cdn (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 86 0.41   6 - 74   83 - 84   89 - 103
2 26 0.67   75 - 82   85 - 88   104 - 117

Sequence


           _____________________________________________________________________73_______82____88____________103________________    
 3cab(A) : DWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVDKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI    
         :                                                                                                                          
 3cdn(A) : *WVPPEVFDLVAEDKARCMSEHGTTQAQIDDVDKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI    
           _____________________________________________________________________73_______82____88____________103________________    

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		8.1
Translation
(A) 		-0.3
Closure
(%) 		34.0
Bending Residues
( green ) 		  73 - 75
  82 - 85
  88 - 89
  103 - 104
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download