Polymerase Acidic Protein

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Polymerase Acidic Protein
  Conformer 1
(PDB) 		8t67 (A)
  Conformer 2
(PDB) 		8vgz (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 137 0.32   1 - 1   5 - 8   38 - 123   125 - 190   193 - 193
2 35 0.53   2 - 4   9 - 37   124 - 124   191 - 192

Sequence


           __1__4__7____________________________37______________________________________________________________123________________ 
 8t67(A) : SAMEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAATCTHLEVCFMYSDFGhRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIK 
         :                                                                                                                          
 8vgz(A) : SAMEDFVRQCFNPMIVELAEKAMKKYGEDPKIETNKFAAICTHLEVCFMYSDGGhRFEIIEGRDRIMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIK 
           __1__4__7____________________________37______________________________________________________________123________________ 

           ________________________________________________190_____                                                                 
 8t67(A) : SEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSE                                                                 
         :                                                                                                                          
 8vgz(A) : SEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSE                                                                 
           ________________________________________________190_____                                                                 

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		5.0
Translation
(A) 		0.1
Closure
(%) 		99.4
Bending Residues
( green ) 		  1 - 2
  4 - 5
  7 - 9
  37 - 38
  123 - 125
  190 - 193
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Mixed

PyMOL Script

Download and extract PyMOL PML script file Download