Calmodulin

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Calmodulin
  Conformer 1
(PDB) 		1ckk (A)
  Conformer 2
(PDB) 		1cdl (A)
  Window Length 11
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 68 1.61   69 - 104   110 - 141
2 64 1.03   10 - 68   105 - 109

Sequence


           __________________________________________________________________68_________________________________104_108____________ 
 1ckk(A) : ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEE 
         :                                                                                                                          
 1cdl(A) : ****TEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEE 
           __________________________________________________________________68_________________________________104_108____________ 

           ____________________________                                                                                             
 1ckk(A) : VDEMIREADIDGDGQVNYEEFVQMMTAK                                                                                             
         :                                                                                                                          
 1cdl(A) : VDEMIREADIDGDGQVNYEEFVQMMT**                                                                                             
           ____________________________                                                                                             

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		17.1
Translation
(A) 		-0.4
Closure
(%) 		88.7
Bending Residues
( green ) 		  68 - 69
  104 - 105
  108 - 110
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download