Pseudoazurin

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Pseudoazurin
  Conformer 1
(PDB) 		4yl4 (A)
  Conformer 2
(PDB) 		5yw3 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 100 0.4   3 - 66   73 - 90   104 - 121
2 20 0.56   67 - 72   91 - 103   122 - 122

Sequence


           ________________________________________________________________66____72________________90__________103_______________12 
 4yl4(A) : ADFEVHMLNKGKDGAMVFEPASLKVAPGDTVTFIPTDKGHNVETIKGMIPDGAEAFKSKINENYKVTFTAPGVYGVKCTPHYGMGMVGVVQVGDAPANLEAVKGAKNPKKAQERLDAALA 
         :                                                                                                                          
 5yw3(A) : ADFEVHMLNKGKDGAMVFEPASLKVAPGDTVTFIPKDKGHNVETIKGMIPDGAEAFKSKINENYKVTFTAPGVYGVKCTPHYGMGMVGVVQVGDAPANLEAVKGAKNPKKAQERLDAALA 
           ________________________________________________________________66____72________________90__________103_______________12 

           1___                                                                                                                     
 4yl4(A) : ALGN                                                                                                                     
         :                                                                                                                          
 5yw3(A) : ALGN                                                                                                                     
           1___                                                                                                                     

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		7.9
Translation
(A) 		-0.5
Closure
(%) 		99.9
Bending Residues
( green ) 		  66 - 67
  72 - 73
  90 - 91
  103 - 104
  121 - 122
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download