Putative Laminarinase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Putative Laminarinase
  Conformer 1
(PDB) 		2w39 (A)
  Conformer 2
(PDB) 		2wlq (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 196 0.23   3 - 10   18 - 21   38 - 44   74 - 95   100 - 100   102 - 121   124 - 249   289 - 296
2 98 0.17   11 - 17   22 - 37   45 - 73   96 - 99   101 - 101   122 - 123   250 - 288

Sequence


           ________10_____17__21______________37_____44___________________________73____________________95__99___________________12 
 2w39(A) : ATYHLEDNWVGSAFLSTFTHEAIADPTHGRVNYVDQATALAKNLTYASGDTLILRADHTTTLSPSGPGRNSVRIRSIKTYTTHVAVFDVRHMPQGCGTWPAAWETDEGDWPNGGEVDIIE 
         :                                                                                                                          
 2wlq(A) : ATYHLEDNWVGSAFLSTFTHEAIADPTHGRVNYVDQATALAKNLTYASGDTLILRADHTTTLSPSGPGRNSVRIRSIKTYTTHVAVFDVRHMPQGCGTWPAAWETDEGDWPNGGSVDIIE 
           ________10_____17__21______________37_____44___________________________73____________________95__99___________________12 

           1_______________________________________________________________________________________________________________________ 
 2w39(A) : GVNDQSPNAMTLHTGANCAMPASRTMTGHATNNNCDVNTDGNTGCGVQAPTANSYGPSFNANGGGWYAMERTNSFIKVWFFPRNAGNVPNDIASGPATINTDNWGTPTAFFPNTNCDIGS 
         :                                                                                                                          
 2wlq(A) : GVNDQSPNAMTLHTGANCAMPASRTMTGHATNNNCDVNTDGNTGCGVQAPTANSYGPSFNANGGGWYAMERTNSFIKVWFFPRNAGNVPNDIASGPATINTDNWGTPTAFFPNTNCDIGS 
           1_______________________________________________________________________________________________________________________ 

           ______249____________________________________288__________                                                               
 2w39(A) : HFDANNIIINLTFCGDWAGQASIFNGAGCPGSCVDYVNNNPSAFANAYWDIASVRVYQ                                                               
         :                                                                                                                          
 2wlq(A) : HFDANNIIINLTFCGDWAGQASIFNGAGCPGSCVDYVNNNPSAFANAYWDIASVRVYQ                                                               
           ______249____________________________________288__________                                                               

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		1.7
Translation
(A) 		-0.2
Closure
(%) 		97.9
Bending Residues
( green ) 		  10 - 11
  17 - 18
  21 - 22
  37 - 38
  44 - 45
  73 - 74
  95 - 96
  99 - 102
  121 - 124
  249 - 250
  288 - 289
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download