16S Rrna Methylase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name 16S Rrna Methylase
  Conformer 1
(PDB) 		3frh (A)
  Conformer 2
(PDB) 		3fri (A)
  Window Length 9
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 200 0.72   11 - 23   48 - 246
2 29 0.52   6 - 10   24 - 47

Sequence


           __________10________20_________________________47_______________________________________________________________________ 
 3frh(A) : YPMNINDALTSILASKKYRALCPDTVRRILTEEWGRHKSPKQTVEAARTRLHGICGAYVTPESLKAAAAALSAGDVKKALSLHASTKERLAELDTLYDFIFSAETPRRVLDIACGLNPLA 
         :                                                                                                                          
 3fri(A) : ***NINDALTSILASKKYRALCPDTVRRILTEEWGRHKSPKQTVEAARTRLHGICGA-vTPESLKAAAAALSAGDVKKALSLHASTKERLAELDTLYDFIFSAETPRRVLDIACGLNPLA 
           __________10________20_________________________47_______________________________________________________________________ 

           ________________________________________________________________________________________________________________________ 
 3frh(A) : LYERGIASVWGCDIHQGLGDVITPFAREKDWDFTFALQDVLCAPPAEAGDLALIFKLLPLLEREQAGSAMALLQSLNTPRMAVSFPTR---nYAAWFEGGLPAEFEIEDKKTIGTELIYL 
         :                                                                                                                          
 3fri(A) : LYERGIASVWGCDIHQGLGDVITPFAREKDWDFTFALQDVLCAPPAEAGDLALIFKLLPLLEREQAGSAMALLQSLNTPRMAVSFPTRSeANYAAWFEGGLPAEFEIEDKKTIGTELIYL 
           ________________________________________________________________________________________________________________________ 

           _____                                                                                                                    
 3frh(A) : IKKN*                                                                                                                    
         :                                                                                                                          
 3fri(A) : IKKNG                                                                                                                    
           _____                                                                                                                    

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		8.9
Translation
(A) 		-0.3
Closure
(%) 		35.4
Bending Residues
( green ) 		  10 - 11
  20 - 24
  47 - 52
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download