Tetracycline Repressor

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Tetracycline Repressor
  Conformer 1
(PDB) 		1bjz (A)
  Conformer 2
(PDB) 		2trt (A)
  Window Length 7
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 103 0.73   62 - 88   111 - 199
2 67 0.4   7 - 61   89 - 100

Sequence


           __________________________________________________________61_________________________88_________99______________________ 
 1bjz(A) : SRLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALLDALAVEILARHHDYSLPAAGESWQSFLRNNAMSFRRALLRYRDGAKVHLGTRPDEKQYDTVETQLRFMT 
         :                                                                                                                          
 2trt(A) : ARLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALLDALAVEILARHHDYSLPAAGESWQSFLRNNAMSFRRALLRYRDGAKVHLGTRPDEKQYDTVETQLRFMT 
           __________________________________________________________61_________________________88_________99______________________ 

           ______________________________________________________________________________                                           
 1bjz(A) : ENGFSLRDGLYAISAVSHFTLGAVLEQQEH----nLPPLLREALQIMDSDDGEQAFLHGLESLIRGFEVQLTALLQIV                                           
         :                                                                                                                          
 2trt(A) : ENGFSLRDGLYAISAVSHFTLGAVLEQQEHTAALnLPPLLREALQIMDSDDGEQAFLHGLESLIRGFEVQLTALLQIV                                           
           ______________________________________________________________________________                                           

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		6.9
Translation
(A) 		-0.2
Closure
(%) 		73.3
Bending Residues
( green ) 		  61 - 62
  88 - 89
  99 - 116
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Mixed

PyMOL Script

Download and extract PyMOL PML script file Download