T4 Lysozyme

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name T4 Lysozyme
  Conformer 1
(PDB) 		172l (A)
  Conformer 2
(PDB) 		209l (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 38 1.73   3 - 4   91 - 100   103 - 106   137 - 158
2 71 1.36   5 - 73   101 - 102
3 30 3.24   107 - 136

Sequence


           ___4________________________________________________________________70______________________________100_________________ 
 172l(A) : MNCFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAA---VRGILRNAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNS 
         :                                                                                                                          
 209l(A) : MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAAAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNS 
           ___4________________________________________________________________70______________________________100_________________ 

           ________________136____________________________                                                                          
 172l(A) : LRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNL                                                                          
         :                                                                                                                          
 209l(A) : LRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYK**                                                                          
           ________________136____________________________                                                                          

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		39.2
Translation
(A) 		-1.4
Closure
(%) 		99.6
Bending Residues
( green ) 		  4 - 12
  70 - 91
  100 - 106
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		24.3
Translation
(A) 		-4.0
Closure
(%) 		90.2
Bending Residues
( green ) 		  103 - 107
  136 - 139
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download