T4 Lysozyme

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name T4 Lysozyme
  Conformer 1
(PDB) 		2lzm (A)
  Conformer 2
(PDB) 		1l75 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 82 0.3   3 - 4   9 - 79   84 - 86   102 - 107
2 76 0.31   5 - 8   80 - 83   87 - 101   108 - 160

Sequence


           ___4___8_____________________________________________________________________79__83_86____________101___107_____________ 
 2lzm(A) : MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRM 
         :                                                                                                                          
 1l75(A) : MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRM 
           ___4___8_____________________________________________________________________79__83_86____________101___107_____________ 

           ____________________________________________                                                                             
 2lzm(A) : LQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNL                                                                             
         :                                                                                                                          
 1l75(A) : LQQKRWAAAAAAAAKSRWYNQTPNRAKRVITTFRTGTWDAYK**                                                                             
           ____________________________________________                                                                             

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		3.6
Translation
(A) 		-0.1
Closure
(%) 		98.7
Bending Residues
( green ) 		  4 - 5
  8 - 9
  79 - 80
  83 - 84
  86 - 87
  101 - 102
  107 - 108
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download