Tripartite Tricarboxylate Transporter Substrate Binding Protein

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Tripartite Tricarboxylate Transporter Substrate Binding Protein
  Conformer 1
(PDB) 		7ndr (C)
  Conformer 2
(PDB) 		7nds (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 162 0.7   23 - 116   242 - 309
2 126 0.81   117 - 241   310 - 310

Sequence


           _____________________________________________________________________________________________115________________________ 
 7ndr(C) : *NQPLKIVVPFSAGGTADVLPRLVAEKIRADYAGGVIIENKPGAGGNIGADLVFRAPPDGMTVLASPPGPIAINHNLYQKLSFDPTRWVPVTILATVPNVLVINPKLPVKSLGEFIAYAK 
         :                                                                                                                          
 7nds(A) : SNQPLKIVVPFSAGGTADVLPRLVAEKIRADYAGGVIIENKPGAGGNIGADLVFRAPPDGMTVLASPPGPIAINHNLYQKLSFDPTRWVPVTILATVPNVLVINPKLPVKSLGEFIAYAK 
           _____________________________________________________________________________________________123________________________ 

           ___________________________________________________________________________________________________241__________________ 
 7ndr(C) : ANPKKVTVATQGDGSTSHLTAAMFMQLTGTELTVIPYKGTAPALIDLIGGNVDVFFDNISSSATYHQAGKVRILAVADEQRSQILPQVPTFAEQQWPAMQAVTFFSVVAPPGTSAEIAQK 
         :                                                                                                                          
 7nds(A) : ANPKKVTVATQGDGSTSHLTAAMFMQLTGTELTVIPYKGTAPALIDLIGGNVDVFFDNISSSATYHQAGKVRILAVADEQRSQILPQVPTFAEQQWPAMQAVTFFSVVAPPGTSAEIAQK 
           ___________________________________________________________________________________________________249__________________ 

           _________________________________________303__________                                                                   
 7ndr(C) : LQKQMALALSSNDIRKHFQEQGAVPCGWDPSKTAQFIRQETEKWKKVLKAANV*                                                                   
         :                                                                                                                          
 7nds(A) : LQKQMALALSSNDIRKHFQEQGAVPCGWDPSKTAQFIRQETEKWKKVLKAANVK                                                                   
           _________________________________________311__________                                                                   

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		41.0
Translation
(A) 		0.1
Closure
(%) 		97.3
Bending Residues
( green ) 		  115 - 117
  241 - 242
  303 - 310
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download