Wss1p

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Wss1p
  Conformer 1
(PDB) 		5xbn (A)
  Conformer 2
(PDB) 		5xbv (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 78 0.22   29 - 56   65 - 115   119 - 122
2 37 0.17   26 - 28   57 - 64   116 - 118   123 - 146

Sequence


           ______28__________________________56______64________________________________________________115____122__________________ 
 5xbn(A) : RIPHKNPHIQKVAVLQSKPNKEDALNLIKEIAHKVSYL-kENHFKVTNLVEFYPRDQRLLG-nVNHGSKI-lRLRCSTDEFQFLP-eCI-gT-lHELTHNLFGPHDKKFYNKLDELIGRQ 
         :                                                                                                                          
 5xbv(A) : ***HKNPHIQKVAVLQSKPNKEDALNLIKEIAHKVSYLMKENHFKVTNLVEFYPRDQRLLGMNVNHGSKIMLRLRCSTDEFQFLPMECIMGTMLHQLTHNLFGPHDKKFYNKLDELIGRQ 
           ______28__________________________56______64________________________________________________115____122__________________ 

           _________                                                                                                                
 5xbn(A) : WVIEQRGL*                                                                                                                
         :                                                                                                                          
 5xbv(A) : WVIEQRGLY                                                                                                                
           _________                                                                                                                

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		3.8
Translation
(A) 		0.1
Closure
(%) 		97.2
Bending Residues
( green ) 		  28 - 29
  56 - 57
  64 - 65
  115 - 116
  118 - 119
  122 - 123
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download