X-31 Influenza Haemagglutinin Ha2

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name X-31 Influenza Haemagglutinin Ha2
  Conformer 1
(PDB) 		6y5g (B)
  Conformer 2
(PDB) 		6y5k (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 105 8.01   63 - 167
2 24 3.14   39 - 62

Sequence


           ________________________________________________________58______________________________________________________________ 
 6y5g(B) : GLFGAIAGFIENGWEGMIDGWYGFRHQNSEGTGQAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFE 
         :                                                                                                                          
 6y5k(B) : ************************************DLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFE 
           ________________________________________________________58______________________________________________________________ 

           ____________________________________________________                                                                     
 6y5g(B) : KTRRQLRENAEEMGNGCFKIYHKCDNACIESIRNGTYDHDVYRDEALNNRFQ                                                                     
         :                                                                                                                          
 6y5k(B) : KTRRQLRENAEEMGNGCFKIYHKCDNACIESIRNGTYDHDVYRDEALNN***                                                                     
           ____________________________________________________                                                                     

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		169.0
Translation
(A) 		4.4
Closure
(%) 		74.9
Bending Residues
( green ) 		  58 - 75
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download