Diamine acetyltransferase 2
Ligand-induced domain movement details

Jmol view of liganded conformation 2

Domain Movement

domain 1 is binding domain(fixed in space) domain 2 is binding domain(fixed in space)

Sequence


           __________________________________________________ 
 2bei(B) : ASVRIREAKEGDCGDILRLIRELAEFEKLSDQVKISEEALRADGFGDNPF 
         :                                                    
 2bei(A) : *SVRIREAKEGDCGDILRLIRELAEFEKL----kISEEALRADGFGDNPF 
           __________________________________________________ 

           __________________78_________89___________________ 
 2bei(B) : YHCLVAEI---cVVGYGIYYFIYSTWKGRTIYLEDIYVpEYRGQGIGSKI 
         :                                                    
 2bei(A) : YHCLVAEILgPCVVGYGIYYFIYSTWKGRTIYLEDIYVpEYRGQGIGSKI 
           __________________78_________89___________________ 

           ______118_________________________________________ 
 2bei(B) : IKKVAEVALDKGCSQFRLAVLDWNQRAdLYKALGAQDLTEAEGWHFFCFQ 
         :                                                    
 2bei(A) : IKKVAEVALDKGCSQFRLAVLDWNQRAdLYKALGAQDLTEAEGWHFFCFQ 
           ______118_________________________________________ 

           __________                                         
 2bei(B) : GEATRKLAGK                                         
         :                                                    
 2bei(A) : GEATRKLAG*                                         
           __________                                         

Details

  Property   Value
 Conformer 1 2bei(B)
 Conformer 2 2bei(A)
 Radius gyration for conformer 1 16.63 A
 Radius gyration for conformer 2 16.58 A
 EC Number 2.3.1.57  
Click here to see the DynDom results or the famliy
 Trigger ligands ACO306
 Trigger ligands in which conformation Conformation  2
 Conformaton with trigger ligands is compact Yes
 Spanning ligands Yes
 Residues in enzyme contacting ligands ALA128  ARG101  ARG135  ASN133  ASP93  GLN103  GLU28  GLU92  GLY102  GLY104  GLY106  ILE105  ILE94  LEU127  LEU139  LEU91  PHE27  SER107  TYR140  TYR95  VAL129  VAL96 
 Residues in extended bending regions contacting ligands ASP93  GLU92  LEU127  LEU91 
 Residues in extended bending regions making H-bonds or salt-bridges with ligands Null
  Residues in extended bending regions with an H-bond between its main chain and ligands Null
Click here to see the details of H-bonds between ligands and enzyme in PDF format generated by LIGPLOT