Type II restriction enzyme PvuII
Ligand-induced domain movement details

Jmol view of liganded conformation 2

Domain Movement

domain 1 is binding domain(fixed in space)	domain 2 is binding domain(fixed in space)

Sequence

______________________________________41__________   1ni0(B) : *HPDLNKLLELWPHIQEYQDLALKHGINDIFQDNGGKLLQVLLITGLTVL           :                                                      1h56(A) : SHPDLNKLLELWPHIQEYQDLALKHGINDIFQDNGGKLLQVLLITGLTVL             ______________________________________41__________             __________________________________________________   1ni0(B) : PGREGNDAVDNAGQEYELKSINIDLTKGFSTHHHMNPVIIAKFRQVPWIF           :                                                      1h56(A) : PGREGNDAVDNAGQEYELKSINIDLTKGFSTHHHMNPVIIAKYRQVPWIF             __________________________________________________             __________________________________________________   1ni0(B) : AIYRGIAIEAIYRLEPKDLEFYYDKWERKWYSDGHKDINNPKIPVKYVME           :                                                      1h56(A) : AIYRGIAIEAIYRLEPKDLEFYYDKWERKWYSDGHKDINNPKIPVKYVME             __________________________________________________             ________                                             1ni0(B) : HGTKIYAA                                                     :                                                      1h56(A) : HGTKIY**                                                       ________

Details

Property   Value  Conformer 1 1ni0(B)  Conformer 2 1h56(A)  Radius gyration for conformer 1 18.18 A  Radius gyration for conformer 2 18.33 A  EC Number 3.1.21.4   Click here to see the DynDom results or the famliy  Trigger ligands MG1  Trigger ligands in which conformation Conformation  2  Conformaton with trigger ligands is compact No  Spanning ligands No  Residues in enzyme contacting ligands ASP58  GLU68  GLY56  LYS70   Residues in extended bending regions contacting ligands Null  Residues in extended bending regions making H-bonds or salt-bridges with ligands Null   Residues in extended bending regions with an H-bond between its main chain and ligands Null Click here to see the details of H-bonds between ligands and enzyme in PDF format generated by LIGPLOT